Workforce · Platform

A corporate LMS that manages learning, not just content.

The traditional corporate LMS is a library with a turnstile: it stores courses and counts who walked through. Future Proof adds the part that was always missing — an engine that makes the material stick and the analytics to prove it did.

Course delivery · adaptive reinforcement · compliance reporting

2 weekstypical time from signed pilot to a first cohort practising on your own content
100%of practice attempts logged with timestamps — the evidence chain an auditor actually asks for
5Bloom levels reported separately on every dashboard, from remembering a rule to applying it under pressure
50–80%of course material forgotten within 90 days when nothing reinforces it — the gap an LMS alone can’t close

Hosting courses was never the hard part

Every LMS can assign a course, play a video and issue a certificate. That workflow ends at exactly the moment learning begins: the weeks after the course, when memory decays on a curve that has been replicated for over a century.

Future Proof keeps working after the course ends. Concepts flow into each employee’s personal review schedule, retrieval happens in short daily sessions, and the retention dashboard shows the one thing a completion report can’t: whether the training is still there in March.

LMS REPORT 96%WHAT REMAINS 34%COURSE ENDAT 90 DAYS© 2026 FUTURE PROOF™
The report your current LMS gives you is the flat line. The line that matters is the one below it — and it’s the one Future Proof measures and bends. Why completion metrics mislead →

Everything an LMS does, still here

Courses, learning paths, enrollment rules, deadlines, certificates and manager approvals — the administrative spine you expect, without the parts your admins curse.

ASSIGNEDCOMPLETEDVERIFIEDRE-VERIFIEDRENEWAL DUE© 2026 FUTURE PROOF™

The layer no LMS has

An adaptive engine schedules per-concept review for every employee after the course — spaced, interleaved and tuned by their answers. It’s the difference between delivered and learned.

100% TAUGHTCOURSE + REVIEWCOURSE ONLYDAY 1DAY 90© 2026 FUTURE PROOF™

Value you can put in a board pack

Retention by quarter, capability by team, risk flags before they become incidents. Training stops reporting activity and starts reporting an asset.

Q1Q2Q3Q4Q5CAPABILITY RETAINED BY QUARTER© 2026 FUTURE PROOF™

What the LMS report never shows

Completion says done; this view says what is still in memory a quarter later, per course, and what to do about the gap.

90-day retention — LMS courses
66%
Fading
9
Schedule refreshers
Retire stale module
Re-verify managers

Interface shown as an illustration with representative numbers, not a screenshot — the layout is the product’s.

Migrating from another LMS?

Course structures and enrollment data come across cleanly, and the two systems can run in parallel during transition.

Replacing an LMS: what actually has to move

The migration, in the order it happens

Course structures and user records import first, and this is the part everyone worries about and nobody should: it is a data mapping exercise measured in days. Historical completions come across as a legacy layer, clearly marked, so tenure-long training transcripts stay intact for anyone who needs them.

The work that actually takes time is the question banks — turning your existing content into reviewed practice material. AI drafting produces the volume; your subject experts approve it. Budget hours of expert attention per course, not weeks, and sequence courses by which expert is available rather than which course feels most important.

Running both systems during the transition

The practice and measurement layer works on top of any LMS, so the honest way to evaluate a replacement is to run them in parallel on one live cohort for a quarter. Your incumbent keeps delivering; the engine measures what its delivery leaves behind.

This is not a hedge — it is the only way to get comparative evidence before a contract decision. Two dashboards describing the same people, one reporting completions and one reporting retention, settles the question faster than any feature matrix. If the retention data does not persuade you, the exit costs a conversation.

What you give up by leaving a traditional LMS

Be clear-eyed about it. Mature enterprise LMS platforms carry deep content-operations tooling: complex catalogue management, e-commerce for training, elaborate multi-audience delivery rules. If those are load-bearing for you, a retention-first platform is a downgrade on that axis and you should weigh it honestly.

What you gain is the layer none of them have. The trade is worth making when your accountability has shifted from delivering training to proving capability — and worth refusing when it has not.

The numbers, and where each one comes from

2 weeksto a live pilot cohort on your own content, running beside the incumbent
100%of attempts logged with timestamps — the evidence chain, not a sample
Daysfor structure and user import; the bank build is the real path
Parallelcomparison on one cohort — measured on your own cohort during the pilot

Questions buyers ask

Is Future Proof a full LMS replacement or an add-on?

Either. It carries the core LMS workflow — courses, paths, enrollment, certificates, deadlines — so it can replace a legacy system outright, or run alongside one as the practice and measurement layer while contracts wind down.

Does it support SCORM content?

You can link out to existing SCORM modules as course material, but the adaptive practice layer works from question banks, which the platform’s AI helps you draft from your content. Most customers find the questions matter far more than the package format.

How does compliance reporting work?

Every assignment, attempt, pass and re-verification is logged with timestamps and exportable. Instead of “94% completed the module”, you hand the auditor “94% verified on the material — here is each person’s evidence trail.”

What integrations exist?

HRIS sync (Zoho People and HROne today, more via a documented API), SSO via SAML 2.0 / OIDC, and export APIs for your BI tools. See the integrations page for the current list.

What does migration actually involve?

Course structure import, user import or HRIS connection, then a question-bank build from your content — typically a few weeks end to end, with the pilot cohort live much earlier.

See it on your own content.

Bring one course. We’ll show you the retention curve your current training leaves behind — and what scheduled review does to it.

  • 30 minutes, on your calendar — pick a slot here
  • Run on your own content wherever possible, not a canned deck
  • You see the dashboards, the learner surface and the evidence exports
  • No commitment — and pilot data stays yours either way